• Mr.Alex
    Tel: 86-0538-6309826

  • Ms.Hope
    Sale Manager
    Tel: 86-17753805875

  • Mr.Jack Smith
    Sale Manager
    Tel: 86-17753805872

  • Ms.Amanda
    Sale Manager
    Tel: 86-17753815871

  • Mr.Alex
    Sale Manager
    Tel: 86-17753815870

  • Mobile:17753815870
  • Tel:86-0538-6309826
  • Fax:86-0538-6309826
  • URL:http://tajy-biological
  • Province/state:Shandong
  • City:Taian
  • Street:Great Wall Road 6, Tai'an City,Shandong Province,China
  • MaxCard:
Home > Products >  IGF-1 LR3 / LONG IGF-1 Peptide Steroid Hormones for Weight Loss

IGF-1 LR3 / LONG IGF-1 Peptide Steroid Hormones for Weight Loss CAS NO.946870-92-4

  • FOB Price: USD 18 /Gram Get Latest Price
  • Min.Order: 10 Gram
  • Payment Terms: T/T,Western Union,MoneyGram,Other
  • Available Specifications:

    Purity 99%(10-100)Gram

  • Product Details

Keywords

  • 946870-92-4
  • IGF-1 LR3
  • LONG IGF-1

Quick Details

  • ProName: IGF-1 LR3 / LONG IGF-1 Peptide Steroi...
  • CasNo: 946870-92-4
  • Appearance: White Powder
  • Application: Pharmaceutical Intermediates
  • DeliveryTime: 2-3 work days
  • PackAge: Disguised Packages
  • Port: Hong Kong
  • ProductionCapacity: 1 Metric Ton/Month
  • Purity: 99% By HPLC
  • Storage: Refrigerator
  • Transportation: TNT,DHL,EUB,ETK,HKEMS
  • LimitNum: 10 Gram

Superiority

FAQ

Q1: Can i get some samples

A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.

Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, Western Union or Paypal or Escrow(Alibaba).

Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples.
You can send us your product specifications and requests,we will manufacture the products according to your requests.

Q4:What's your MOQ
A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.

Q5: How about delivery leadtime
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)

Q6:Is there a discount
A:Different quantity has different discount.

Q7: How do you treat quality complaint
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.

Q8: How to contact us
A:You can chat with us by Trademanager, whatsapp & Skype Online.
You can choose your interested products and send inquiry to us.
You can dial our telephone directly, you will get our reply.

 

Details

 

 

IGF-1 LR3 /LONG IGF-1 CAS 946870-92-4 for Weight Loss 1mg/vial Factory Direct sales

 

Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1,
LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.

 

Description: The LR3 is a long-term analog of human IGF-1, specifically designed and
manufactured for mammalian cell culture to support large-scale manufacturing of recombinant
biopharmaceuticals. Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E.Coli is
a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular
mass of 9.1kDa.

 

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Amino Acid Sequence:
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV
DECCFRSCDLRRLEMYCAPLKPAKSA.

 

Source: Escherichia Coli

 

Formulation:
Lyophilized from a 0.2 μm filtered solution of 300mM HAc-NaAc, pH 6.5.

 

Stability:
Lyophilized LR3 IGF1 altho µ gh stable at room temperature for 3 weeks, should be stored
desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7
days and for future use below -18°C.For long term storage it is recommended to add a carrier
protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.


Usage:
The products are furnished for LABORATORY RESEARCH USE ONLY. The product may
not be used as dr µ gs, agricultural or pesticidal products, food additives or household chemicals.

 

IGF-1 LR3 is an endocrine hormone that is produced in the liver. The production of IGF-1 is increased in the presence of hormone. There are many different types of cells in the body that are equipped with a receptor to accept IGF-1. This makes a good protagonist at targeting tissues to spur cell to cell communication (growth) or in a more autocrine cell signaling process that facilitates cell division.

 

 

What is IGF1-LR3
IGF-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF dose actually stand for insulin-like growth factor. IGF-1 is mainly responsible for long bone growth in children and it also affects muscle growth and repair of adults. Long R3 IGF-1 is a more potent version of IGF-1. It's chemically altered i like to think "enhanced" to prevent deactivation by IGF-1 binding proteins in the bloodstream. This results in a longer half-life of 20-30 hours instead of 20 min... So that means a far more effective version than the short chain we we re perhaps more familiar with.
Long arginine 3-IGF-1, abbreviated as IGF-1 LR3 or LR3-IGF-1, is a synthetic protein and lengthened analogue of human insulin-like growth factor 1 (IGF-1).

 

What You Need to Know about IGF-1 LR3 / DES
If you want big muscle gains, you'll find that learning about the injectable peptide known as IGF-1 LR3/DES is well worth your time. This peptide is fortified with a growth factor, IGF, which has insulin-like properties.

 

IGF1-LR3 What does it do
IGF-1 LR3 greatly boosts muscle mass by inducing a state of muscle hyperplasia (increase in number of new muscle cells) in the MUSCLE WHERE ITS INJECTED! So think of it as muscle cell proliferation, or even the splitting of the cell so 1 becomes 2... That's why its perfect on cycle when you get increased muscle cell growth too. But why is better than The reason being is causes levels to rise in the liver first, then then the muscle, Whereas IGF-LR3 causes localized IGF levels to rocket.
Igf1-lr3 As you all know is the long acting version of Igf-1, Taking its active potential up towards 20 hours, But along with its ability to stimulate the growth of satellite muscle cells and helping them to mature into new muscle fibers it holds the ability to increase the uptake of many supplements we currently use, And it can cause the enhanced recovery of testicle size, and prevent muscle loss even in PCT. Plus another reason its so potent is because of the decreased binding of Long R3 IGF-1 to all known IGF binding proteins. These binding proteins normally inhibit the biological actions of IGF.. not so with this long acting version.

 

Benefits of IGF-1 LR3/DES
Natural IGF production decreases as we age and this means that lower levels of this hormone trigger the process known as cell reduction. Cell reduction is the opposite of growth - it signals slowdown and this is why people fight the aging process with IGF-1 LR3/DES. Those who utilize this peptide in either format (LR3 or DES) are doing so in order to boost IGF levels with a mind to optimizing growth. The hormone, IGF-1, is manufactured within the liver organ. Natural production of this hormone rises when a growth hormone is also present. A lot of cells within the human body are equipped with receptors that do accept IGF-1. For this reason, it's an excellent choice in terms of being a peptide which is able to "find" tissue which will spark communication between cells. This communication is growth. When you choose this peptide, you'll be able to lose fat deposits, as the formula will assist your body with regulating the usage of fats for energy. As well, you'll find that this peptide is an anti-aging treatment, since it spurs enhanced cell production. Aging slows down cell regeneration and this peptide restores youthful cell production. As well, you may access long-term health benefits from treatment with IGF-1, as lower levels of this important hormone tend to raise health risks for heart problems. By boosting your IGF-1 levels, you may just protect your heart from damage or failure. In addition, you may access better lower brain cell regeneration and function. It will slow down muscle tissue degeneration and it will also assist with the synthesis of proteins. As you can see, IGF-1 is rather powerful. It assists the body with growth in many different ways and, by doing so, keeps the body in a more youthful state. This is why this peptide is such a popular choice with weightlifters and athletes. The primary benefit of choosing this peptide is its ability to trigger hyperplasia (splitting of cells) within the cells of the muscles. This splitting of cells creates a fuller muscle look which is very pleasing to the eye. More cells equal the appearance of more mass. If you're interested in building the perfect body, you'll find that adding this peptide to your regimen will help you to build the muscle that you want. Fuller muscles are symbols of sheer strength and power and they are also important aspects of aesthetics (particularly for bodybuilders!). Without the right degree of muscle fullness, you may never access the proportional and inspiring figure or physique that you want! This peptide has the ability to change your body so that it's able to create better muscle density over the long term! This happens due to hyperplasia and it gives users the power to become more muscular, just by following an injection regimen and continuing with their usual training routines. Those who use steroids may benefit from treatment with the IGF-1 peptide, as its ability to spark hyperplasia assists the body with pushing through hypertrophy. IGF-1 and steroids will work together in order to grow bigger muscles. This is why this peptide is often stacked with steroids.

 

Which Form is Right for You
The LR3 form features a half-life of twenty to thirty hours and it's more powerful than the typical IGF-1 peptide. LR3 will act in the body for a full day, more or less, and bind to receptors within cells, thereby spurring growth and inspiring weight loss. LR3 stops blood sugar from entering cells and this means that the body will need to burn fat, rather than glucose. The DES form is a short version of an IGF chain. Its potent compared to LR3 and may offer ten times the power when compared to basic IGF-1. DES has a half-life of about half an hour, which is due to the delicacy of this chain. So, it should be injected into the area that you want to grow! DES is the best choice for long-term injections. LR3 is better for short cycles.

 

Does This Peptide Cause Side Effects
In bigger doses, this peptide may trigger hypoglycemia. In addition, it may boost tumor size in those who have cancer. The peptide doesn't cause cancer to develop. Other symptoms which may occur during therapy with this peptide include headaches and bruising from improper injections. Make sure you know how to self-inject before you start using this formula and always follow instructions which come with your supply of this peptide. Never take more than directed and cease injections if side effects occur. Then, seek out medical attention right away. Some people manage headaches with aspirin. Others have no side effects at all.

 

 

Payment & Packing:
MOQ: 10g or 100ml
Payment Terms: Western union,Money gram,TT,Bitcoin
Packing:Disguised or as your required
Shipping way:EMS, HKEMS, DHL, Fedex, UPS or as your required


Superiority
1, High quality with competitive price:
1) Standard:BP/USP/EP/Enterprise standard
2) All Purity≥99%
3) We are manufacturer and can provide high quality products with factory price.


2, Fast and safe delivery
1) Parcel can be sent out in 24 hours after payment.Tracking number available
2) Secure and discreet shipment.Various transportation methods for your choice.
3) Customs pass rate ≥99%
4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,
and we have stock in there for transferring.

3, We have clients throughout the world.
1) Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their desire.
2) Market feedback and goods feedback will be appreciated, meeting customers's requirement is our responsibility.
3) High quality,competitive price,fast delivery ,first-class service gain the trust and praise from the customers

How to Proceed Your Orders
Step 1
You confirm all details, and offer us purchasing order.
Step 2
We send the detail price of our product and offer the suitable shipping method for reference.
Step 3
You confirm the order and pay money 100% in advance and send us the detailed contacting
information, including contacting person/company, address, mobile number,ZIP code and your
special requirements.
Step4
Parcel would be arranged within 12 hours upon receipt of your payment .
Photos would be offered to tell apart the products .
Tracking number :
Send by EMS, the tracking number is availabe within 12 hours . The info would be trackable
that day or 1 day later.
If send by HKEMS or other express,the tracking number would be provided next day. And this
does not mean the info is trackable that day. It would be released on internet 2 or 3 days later .
The reason why is that parcel should be shipped to Hongkong from forwarder then wait for
the flight .
You sign for the parcel , deliveried.
Step 5
We offer after-sales service after you receive parcel.


As a responsible supplier of Raw Steroid Powder, Oral and Injectable Steroid, Steroid Solvent and Peptides, we offer a 100% delivery guarantee. If your parcels do not arrive in time we re-ship. By some reasons you are not satisfied or you have any concerns, our hassle-free money back policy allows you to contact us within 30 days of package arrival.

The chemical is processed in completely hygienic environment which keep it pure and safe. The gamut is known for its high stability, accurate composition, effectiveness and reliability. It is used in various pharmaceutical sectors for making tablets, capsules or other components. We are professional, we can provide all technical support and equipments you need to do steroid at home or for business. Welcome to join us, we go further together!!

Major Market: United_States, United_Kingdom, Australia, Canada, Sweden, Russia, Poland, Brazil, Israel, Netherlands, Germany, Puerto_Rico, Uzbekistan, Japan, Spain, Switzerland, Poland and so on.
After-sale Service : Discounts are available for our second-time customers. We can provide recipes and professional suggestions to promote yourselves. Tracking number and packing photoes can be given quickly after your goods sent. We are always here waiting for you!

 

Product Dosage
HGH 176-191 2mg/vial
GHRP-2 5mg/vial
GHRP-2 10mg/vial
GHRP-6 5mg/vial
GHRP-6 10mg/vial
MGF 2mg/vial
PEG MGF 2mg/vial
CJC-1295 with DAC 2mg/vial
CJC-1295 without DAC 2mg/vial
PT-141 10mg/vial
Melanotan-1 10mg/vial
Melanotan-2 10mg/vial
Ipamorelin 2mg/vial
Hexarelin 2mg/vial
Sermorelin 2mg/vial
Oxytocin 2mg/vial
TB500 2mg/vial
Pentadecapeptide BPC 157 2mg/vial
Triptorelin 2mg/vial
Gonadorelin 2mg/vial
Gonadorelin 10mg/vial
Tesamorelin 2mg/vial
DSIP 2mg/vial
Selank 5mg/vial

Other products of this supplier

Other Related Products:303-42-4 72-63-9 66004-57-7 13425-31-5 103-36-6 541-15-1 1045-69-8

lookchemhot product CAS New CAS

平平安安备案网站